PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015898184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 584aa    MW: 65033.1 Da    PI: 5.9079
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015898184.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4355.5e-1332145831373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ecA+a+s+++ e  ++l+++ ++++s +g+p+qRl ay++e+L ar + s++++y+al+++e +   s++ l+++++++e++P+lkf++
  XP_015898184.1 214 LKQLLIECAKALSENNIEVFDSLIEKARDTVSISGEPIQRLGAYMVEGLVARKHASGTNIYRALKCREPE---SKDLLSYMHILYEICPYLKFGY 305
                     689******************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++aN aI ea  +e+ +HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + l ++g+rL+ + e++++p+ef+  v     d
  XP_015898184.1 306 MAANGAIAEACRNEDNIHIIDFQIAQGTQWMTLLQALAARPSGAPHVRITGIDDPVSQyaRGDGLDAVGRRLSAISEKFNIPVEFHG-VPVFAPD 399
                     *******************************************************999999**************************.6888999 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L+v+pgEalaVn+ lqlh+++desv+++++rd +L++vkslsPkvv++veqe+++n+++F++rf+e+l+yy a+f+s++++lpr+ +eri
  XP_015898184.1 400 ITIEMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLSPKVVTLVEQESNTNTTPFFNRFVETLDYYLAMFESIDVTLPRNCKERI 494
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     +vE+++l+r+ivn++aceg+er+erhe ++kW++rl++aGF+++pls+++++ + +llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  XP_015898184.1 495 NVEQHCLARDIVNIIACEGKERVERHELFGKWKSRLTMAGFRQYPLSSYVNSVIGSLLRCYS-EHYTLVEKDGAMLLGWKDRNLISASAW 583
                     **********************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.113188565IPR005202Transcription factor GRAS
PfamPF035141.9E-130214583IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MDSHQFFRIG VTGSSLSSIP STISSIPNRL LGSLKFDLGN SPNSPFSTYF ESDTLTTLSD  60
SQEQHSSTDN LSGVSPSCNS SLETNSYFHQ LSPSVDCRGD SLQLYSGRTS FLQDANHSTP  120
NIQHALQELE TALMAPDDDE VATPNASSGQ SNRPMTSGQR SMSWNQERQG GSRVIQRQSS  180
LVHRHGQSVD NARTEKRHKA MEDACLPSFP PDDLKQLLIE CAKALSENNI EVFDSLIEKA  240
RDTVSISGEP IQRLGAYMVE GLVARKHASG TNIYRALKCR EPESKDLLSY MHILYEICPY  300
LKFGYMAANG AIAEACRNED NIHIIDFQIA QGTQWMTLLQ ALAARPSGAP HVRITGIDDP  360
VSQYARGDGL DAVGRRLSAI SEKFNIPVEF HGVPVFAPDI TIEMLDVRPG EALAVNFPLQ  420
LHHTPDESVD VNNPRDGLLR MVKSLSPKVV TLVEQESNTN TTPFFNRFVE TLDYYLAMFE  480
SIDVTLPRNC KERINVEQHC LARDIVNIIA CEGKERVERH ELFGKWKSRL TMAGFRQYPL  540
SSYVNSVIGS LLRCYSEHYT LVEKDGAMLL GWKDRNLISA SAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-602165846375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898184.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1-like
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM5X9Y90.0M5X9Y9_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein